PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46680.1
Common NameATHB7, ATHB-7, HB-7, T3A4.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 258aa    MW: 30510.8 Da    PI: 5.4852
Description homeobox 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46680.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.1e-193285356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 + ++f++eq++ Le +Fe++  +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  AT2G46680.1 32 NQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWK 85
                 6689*************************************************9 PP

2HD-ZIP_I/II124.26.1e-4032123293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ++rr+s+eq+k+LE++Fe+e++Lep++Kv+lareLglqprqva+WFqn+RAR+k+kqlE++y+ L+++yd+l+++ e+L+ke+++L +el++
  AT2G46680.1  32 NQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSELQR 123
                  68**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-181989IPR009057Homeodomain-like
PROSITE profilePS5007117.6532787IPR001356Homeobox domain
CDDcd000864.05E-143088No hitNo description
SMARTSM003897.0E-163091IPR001356Homeobox domain
PfamPF000463.6E-163285IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-183394IPR009057Homeodomain-like
PRINTSPR000317.8E-65867IPR000047Helix-turn-helix motif
PROSITE patternPS0002706285IPR017970Homeobox, conserved site
PRINTSPR000317.8E-66783IPR000047Helix-turn-helix motif
PfamPF021835.1E-1687128IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MTEGGEYSPA MMSAEPFLTM KKMKKSNHNK NNQRRFSDEQ IKSLEMMFES ETRLEPRKKV  60
QLARELGLQP RQVAIWFQNK RARWKSKQLE TEYNILRQNY DNLASQFESL KKEKQALVSE  120
LQRLKEATQK KTQEEERQCS GDQAVVALSS THHESENEEN RRRKPEEVRP EMEMKDDKGH  180
HGVMCDHHDY EDDDNGYSNN IKREYFGGFE EEPDHLMNIV EPADSCLTSS DDWRGFKSDT  240
TTLLDQSSNN YPWRDFWS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.1360.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453610730.0
Genevisible266327_at0.0
Expression AtlasAT2G46680-
AtGenExpressAT2G46680-
ATTED-IIAT2G46680-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Functional Description ? help Back to Top
Source Description
TAIRencodes a putative transcription factor that contains a homeodomain closely linked to a leucine zipper motif. Transcript is detected in all tissues examined. Is transcriptionally regulated in an ABA-dependent manner and may act in a signal transduction pathway which mediates a drought response.
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Function -- GeneRIF ? help Back to Top
  1. demonstrate that ATHB7 and ATHB12 have essential functions in the primary response to drought, as mediators of a negative feedback effect on ABA signalling in the plant response to water deficit
    [PMID: 22968620]
  2. The results suggested that AtHB7 and AtHB12 evolved divergently to fine tune processes associated with development and responses to mild water stress.
    [PMID: 24884528]
  3. In this study, an attempt has been made to improve CT in drought hardy crop, peanut (Arachis hypogaea L., cv. TMV2) by co-expressing stress-responsive transcription factors (TFs), AtDREB2A, AtHB7 and AtABF3, associated with downstream gene expression
    [PMID: 25474740]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G40950 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G33380(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65310
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0458260.0AY045826.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-7 (At2g46680) mRNA, complete cds.
GenBankAY0913640.0AY091364.1 Arabidopsis thaliana putative homeodomain transcription factor protein ATHB-7 (At2g46680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182191.10.0homeobox-leucine zipper protein ATHB-7
SwissprotP468970.0ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLF4IJ860.0F4IJ86_ARATH; Homeobox-leucine zipper protein ATHB-7
STRINGAT2G46680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Olsson AS,Engström P,Söderman E
    The homeobox genes ATHB12 and ATHB7 encode potential regulators of growth in response to water deficit in Arabidopsis.
    Plant Mol. Biol., 2004. 55(5): p. 663-77
    [PMID:15604708]
  5. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  6. Liu JX,Srivastava R,Che P,Howell SH
    Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.
    Plant J., 2007. 51(5): p. 897-909
    [PMID:17662035]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Aprile A, et al.
    Transcriptional profiling in response to terminal drought stress reveals differential responses along the wheat genome.
    BMC Genomics, 2009. 10: p. 279
    [PMID:19552804]
  9. Mishra KB, et al.
    Engineered drought tolerance in tomato plants is reflected in chlorophyll fluorescence emission.
    Plant Sci., 2012. 182: p. 79-86
    [PMID:22118618]
  10. Vald
    The homeodomain-leucine zipper (HD-Zip) class I transcription factors ATHB7 and ATHB12 modulate abscisic acid signalling by regulating protein phosphatase 2C and abscisic acid receptor gene activities.
    Plant Mol. Biol., 2012. 80(4-5): p. 405-18
    [PMID:22968620]
  11. Capella M,R
    Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB.
    Plant Cell Rep., 2014. 33(6): p. 955-67
    [PMID:24531799]
  12. R
    Arabidopsis AtHB7 and AtHB12 evolved divergently to fine tune processes associated with growth and responses to water stress.
    BMC Plant Biol., 2014. 14: p. 150
    [PMID:24884528]
  13. Pruthvi V,Narasimhan R,Nataraja KN
    Simultaneous expression of abiotic stress responsive transcription factors, AtDREB2A, AtHB7 and AtABF3 improves salinity and drought tolerance in peanut (Arachis hypogaea L.).
    PLoS ONE, 2014. 9(12): p. e111152
    [PMID:25474740]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  15. S
    Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 26(1): p. 145-54
    [PMID:7948864]
  16. Söderman E,Mattsson J,Engström P
    The Arabidopsis homeobox gene ATHB-7 is induced by water deficit and by abscisic acid.
    Plant J., 1996. 10(2): p. 375-81
    [PMID:8771791]
  17. Lee YH,Chun JY
    A new homeodomain-leucine zipper gene from Arabidopsis thaliana induced by water stress and abscisic acid treatment.
    Plant Mol. Biol., 1998. 37(2): p. 377-84
    [PMID:9617808]